Class b: All beta proteins [48724] (178 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein) |
Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (3 species) |
Species Bacillus subtilis [TaxId:1423] [102019] (1 PDB entry) |
Domain d2vhla1: 2vhl A:3-57,A:359-394 [168609] Other proteins in same PDB: d2vhla2, d2vhlb2 complexed with fe, glp, pge |
PDB Entry: 2vhl (more details), 2.05 Å
SCOPe Domain Sequences for d2vhla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhla1 b.92.1.5 (A:3-57,A:359-394) N-acetylglucosamine-6-phosphate deacetylase, NagA {Bacillus subtilis [TaxId: 1423]} esllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvllpXsvtv gkdadlvivssdcevilticrgniafiskead
Timeline for d2vhla1: