![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
![]() | Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) ![]() |
![]() | Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein) |
![]() | Protein Pyruvate kinase, C-terminal domain [52937] (6 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82431] (4 PDB entries) |
![]() | Domain d2vgbd3: 2vgb D:440-573 [168551] Other proteins in same PDB: d2vgba1, d2vgba2, d2vgbb1, d2vgbb2, d2vgbc1, d2vgbc2, d2vgbd1, d2vgbd2 complexed with fbp, k, mn, pga |
PDB Entry: 2vgb (more details), 2.73 Å
SCOPe Domain Sequences for d2vgbd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vgbd3 c.49.1.1 (D:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllsryrpraaviavtrs aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr pgsgytnimrvlsi
Timeline for d2vgbd3: