Lineage for d2vgbd3 (2vgb D:440-573)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 993924Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 993925Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 993926Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 993927Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 993948Species Human (Homo sapiens) [TaxId:9606] [82431] (4 PDB entries)
  8. 993952Domain d2vgbd3: 2vgb D:440-573 [168551]
    Other proteins in same PDB: d2vgba1, d2vgba2, d2vgbb1, d2vgbb2, d2vgbc1, d2vgbc2, d2vgbd1, d2vgbd2
    complexed with fbp, k, mn, pga

Details for d2vgbd3

PDB Entry: 2vgb (more details), 2.73 Å

PDB Description: human erythrocyte pyruvate kinase
PDB Compounds: (D:) pyruvate kinase isozymes r/l

SCOPe Domain Sequences for d2vgbd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgbd3 c.49.1.1 (D:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllsryrpraaviavtrs
aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr
pgsgytnimrvlsi

SCOPe Domain Coordinates for d2vgbd3:

Click to download the PDB-style file with coordinates for d2vgbd3.
(The format of our PDB-style files is described here.)

Timeline for d2vgbd3: