Class a: All alpha proteins [46456] (284 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (3 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (13 proteins) |
Protein Interleukin-4 (IL-4) [47291] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47292] (16 PDB entries) |
Domain d1iara_: 1iar A: [16853] Other proteins in same PDB: d1iarb1, d1iarb2 mutant |
PDB Entry: 1iar (more details), 2.3 Å
SCOP Domain Sequences for d1iara_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iara_ a.26.1.2 (A:) Interleukin-4 (IL-4) {Human (Homo sapiens) [TaxId: 9606]} hkcditlqeiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhe kdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlktim rekyskcss
Timeline for d1iara_: