Lineage for d2vfgb_ (2vfg B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 968087Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 968088Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 968089Protein Triosephosphate isomerase [51353] (20 species)
  7. 968160Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51359] (20 PDB entries)
    Uniprot Q07412
  8. 968179Domain d2vfgb_: 2vfg B: [168510]
    automated match to d1lyxa_
    complexed with 3pg; mutant

Details for d2vfgb_

PDB Entry: 2vfg (more details), 1.95 Å

PDB Description: crystal structure of the f96h mutant of plasmodium falciparum triosephosphate isomerase with 3-phosphoglycerate bound at the dimer interface
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d2vfgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vfgb_ c.1.1.1 (B:) Triosephosphate isomerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
iqnvskfgngsytgevsaeiakdlnieyviighherrkyfhetdedvreklqaslknnlk
avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
iiksam

SCOPe Domain Coordinates for d2vfgb_:

Click to download the PDB-style file with coordinates for d2vfgb_.
(The format of our PDB-style files is described here.)

Timeline for d2vfgb_: