Lineage for d2veka_ (2vek A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 968087Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 968088Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 968089Protein Triosephosphate isomerase [51353] (20 species)
  7. 968279Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)
  8. 968287Domain d2veka_: 2vek A: [168489]
    automated match to d1dkwa_
    complexed with asf, cit, tbu; mutant

Details for d2veka_

PDB Entry: 2vek (more details), 1.6 Å

PDB Description: structure-based enzyme engineering efforts with an inactive monomeric tim variant: the importance of a single point mutation for generating an active site with suitable binding properties
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d2veka_:

Sequence, based on SEQRES records: (download)

>d2veka_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
irswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq

Sequence, based on observed residues (ATOM records): (download)

>d2veka_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwksgspslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvia
aqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviaciget
lqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahali
rswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq

SCOPe Domain Coordinates for d2veka_:

Click to download the PDB-style file with coordinates for d2veka_.
(The format of our PDB-style files is described here.)

Timeline for d2veka_: