Lineage for d2ve1a_ (2ve1 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 963404Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 963405Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins)
    common fold is rather distorted
  6. 963457Protein automated matches [190217] (3 species)
    not a true protein
  7. 963458Species Emericella nidulans [TaxId:162425] [186976] (12 PDB entries)
  8. 963469Domain d2ve1a_: 2ve1 A: [168485]
    automated match to d1bk0a_
    complexed with fe2, m11, w2x

Details for d2ve1a_

PDB Entry: 2ve1 (more details), 2.2 Å

PDB Description: isopenicillin n synthase with substrate analogue asmcov (oxygen exposed 1min 20bar)
PDB Compounds: (A:) isopenicillin n synthetase

SCOPe Domain Sequences for d2ve1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ve1a_ b.82.2.1 (A:) automated matches {Emericella nidulans [TaxId: 162425]}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglvslinkngqt

SCOPe Domain Coordinates for d2ve1a_:

Click to download the PDB-style file with coordinates for d2ve1a_.
(The format of our PDB-style files is described here.)

Timeline for d2ve1a_: