SCOPe 2.07: Domain d2vd2a_: 2vd2 A:

Lineage for d2vd2a_ (2vd2 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187940] (8 PDB entries)

8. Domain d2vd2a_: 2vd2 A: [168463]
   automated match to d1z7me1

Details for d2vd2a_

PDB Entry: 2vd2, 2.85 Å

PDB Description: the crystal structure of hisg from b. subtilis

PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d2vd2a_:

Sequence; same for both SEQRES and ATOM records:

>d2vd2a_ c.94.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
amgklltmampkgrifeeaagllrqagyrlpeefedsrkliidvpeenlrfilakpmdvt
tyvehgvadvgiagkdvmleeerdvyevldlniskchlavaglpntdwsgvapriatkyp
nvassyfreqgeqveiiklngsielapligladrivdivstgqtlkenglvetehicdit
srfivnpvsyrmkddvidemasrlslvveget

Timeline for d2vd2a_:

• d2vd2a_ first appeared in SCOPe 2.01
  
• d2vd2a_ appears in SCOPe 2.06
  
• d2vd2a_ appears in the current release, SCOPe 2.08