SCOP 1.69: Domain d1eera_: 1eer A:

Lineage for d1eera_ (1eer A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (11 proteins)

6. Protein Erythropoietin [47287] (1 species)
   long chain cytokine with a short-chain cytokine topology

7. Species Human (Homo sapiens) [TaxId:9606] [47288] (3 PDB entries)

8. Domain d1eera_: 1eer A: [16846]
   Other proteins in same PDB: d1eerb1, d1eerb2, d1eerc1, d1eerc2

Details for d1eera_

PDB Entry: 1eer, 1.9 Å

PDB Description: crystal structure of human erythropoietin complexed to its receptor at 1.9 angstroms

SCOP Domain Sequences for d1eera_:

Sequence; same for both SEQRES and ATOM records:

>d1eera_ a.26.1.2 (A:) Erythropoietin {Human (Homo sapiens)}
apprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqa
vevwqglallseavlrgqallvkssqpweplqlhvdkavsglrslttllralgaqkeais
nsdaasaaplrtitadtfrklfrvysnflrgklklytgeacrtgdr

Timeline for d1eera_:

• d1eera_ first appeared (with stable ids) in SCOP 1.55
  
• d1eera_ appears in SCOP 1.67
  
• d1eera_ appears in SCOP 1.71
  
• d1eera_ appears in the current release, SCOPe 2.08