![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein Erythropoietin [47287] (1 species) long chain cytokine with a short-chain cytokine topology |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47288] (3 PDB entries) |
![]() | Domain d1eera_: 1eer A: [16846] Other proteins in same PDB: d1eerb1, d1eerb2, d1eerc1, d1eerc2 |
PDB Entry: 1eer (more details), 1.9 Å
SCOPe Domain Sequences for d1eera_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eera_ a.26.1.2 (A:) Erythropoietin {Human (Homo sapiens) [TaxId: 9606]} apprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqa vevwqglallseavlrgqallvkssqpweplqlhvdkavsglrslttllralgaqkeais nsdaasaaplrtitadtfrklfrvysnflrgklklytgeacrtgdr
Timeline for d1eera_:
![]() Domains from other chains: (mouse over for more information) d1eerb1, d1eerb2, d1eerc1, d1eerc2 |