Lineage for d1eera_ (1eer A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705549Protein Erythropoietin [47287] (1 species)
    long chain cytokine with a short-chain cytokine topology
  7. 2705550Species Human (Homo sapiens) [TaxId:9606] [47288] (3 PDB entries)
  8. 2705551Domain d1eera_: 1eer A: [16846]
    Other proteins in same PDB: d1eerb1, d1eerb2, d1eerc1, d1eerc2

Details for d1eera_

PDB Entry: 1eer (more details), 1.9 Å

PDB Description: crystal structure of human erythropoietin complexed to its receptor at 1.9 angstroms
PDB Compounds: (A:) erythropoietin

SCOPe Domain Sequences for d1eera_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eera_ a.26.1.2 (A:) Erythropoietin {Human (Homo sapiens) [TaxId: 9606]}
apprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqa
vevwqglallseavlrgqallvkssqpweplqlhvdkavsglrslttllralgaqkeais
nsdaasaaplrtitadtfrklfrvysnflrgklklytgeacrtgdr

SCOPe Domain Coordinates for d1eera_:

Click to download the PDB-style file with coordinates for d1eera_.
(The format of our PDB-style files is described here.)

Timeline for d1eera_: