| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (75 species) not a true protein |
| Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [188471] (1 PDB entry) |
| Domain d2vc6b_: 2vc6 B: [168455] automated match to d1dhpa_ |
PDB Entry: 2vc6 (more details), 1.95 Å
SCOPe Domain Sequences for d2vc6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vc6b_ c.1.10.0 (B:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
mfegsitalvtpfaddridevalhdlvewqieegsfglvpcgttgesptlskseheqvve
itiktangrvpviagagsnstaeaiafvrhaqnagadgvlivspyynkptqegiyqhfka
idaastipiivynipgrsaieihvetlarifedcpnvkgvkdatgnllrpslermacged
fnlltgedgtalgymahgghgcisvtanvapalcadfqqaclngdfaaalklqdrlmplh
ralfletnpagakyalqrlgrmrgdlrlplvtispsfqeeiddamrhagill
Timeline for d2vc6b_: