SCOPe 2.07: Domain d2vc6a_: 2vc6 A:

Lineage for d2vc6a_ (2vc6 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (91 species)
   not a true protein

7. Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [188471] (1 PDB entry)

8. Domain d2vc6a_: 2vc6 A: [168454]
   automated match to d1dhpa_

Details for d2vc6a_

PDB Entry: 2vc6, 1.95 Å

PDB Description: structure of mosa from s. meliloti with pyruvate bound

PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d2vc6a_:

Sequence; same for both SEQRES and ATOM records:

>d2vc6a_ c.1.10.0 (A:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
mfegsitalvtpfaddridevalhdlvewqieegsfglvpcgttgesptlskseheqvve
itiktangrvpviagagsnstaeaiafvrhaqnagadgvlivspyynkptqegiyqhfka
idaastipiivynipgrsaieihvetlarifedcpnvkgvkdatgnllrpslermacged
fnlltgedgtalgymahgghgcisvtanvapalcadfqqaclngdfaaalklqdrlmplh
ralfletnpagakyalqrlgrmrgdlrlplvtispsfqeeiddamrhagill

Timeline for d2vc6a_:

• d2vc6a_ first appeared in SCOPe 2.01
  
• d2vc6a_ appears in SCOPe 2.06
  
• d2vc6a_ appears in the current release, SCOPe 2.08