|  | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) | 
|  | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites | 
|  | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)  the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel | 
|  | Family c.1.9.0: automated matches [191327] (1 protein) not a true family | 
|  | Protein automated matches [190150] (34 species) not a true protein | 
|  | Species Sulfolobus solfataricus [TaxId:2287] [188418] (16 PDB entries) | 
|  | Domain d2vc5b_: 2vc5 B: [168451] automated match to d2d2ga1 complexed with co, edo, fe, gol | 
PDB Entry: 2vc5 (more details), 2.6 Å
SCOPe Domain Sequences for d2vc5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vc5b_ c.1.9.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mriplvgkdsieskdigftlihehlrvfseavrqqwphlynedeefrnavnevkramqfg
vktivdptvmglgrdirfmekvvkatginlvagtgiyiyidlpfyflnrsideiadlfih
dikegiqgtlnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle
qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygldlflpvdkrnettl
rlikdgysdkimishdycctidwgtakpeykpklaprwsitlifedtipflkrngvneev
iatifkenpkkffs
Timeline for d2vc5b_: