SCOPe 2.08: Domain d2vbjb_: 2vbj B:

Lineage for d2vbjb_ (2vbj B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.2: Homing endonucleases [55608] (3 families)

5. Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
   contains two extra helices in the C-terminal extension

6. Protein automated matches [190411] (4 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [187286] (9 PDB entries)

8. Domain d2vbjb_: 2vbj B: [168440]
   automated match to d1bp7a_
   protein/DNA complex; complexed with ca

Details for d2vbjb_

PDB Entry: 2vbj, 1.95 Å

PDB Description: molecular basis of human xpc gene recognition and cleavage by engineered homing endonuclease heterodimers

PDB Compounds: (B:) DNA endonuclease I-crei

SCOPe Domain Sequences for d2vbjb_:

Sequence; same for both SEQRES and ATOM records:

>d2vbjb_ d.95.2.1 (B:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ntkynkefllylagfvdadgsiiaqiepnqsskfkhrlkltfqvtqktqrrwfldklvde
igvgyvrdsgsvsnyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravld

Timeline for d2vbjb_:

• d2vbjb_ first appeared in SCOPe 2.01
  
• d2vbjb_ appears in SCOPe 2.07