Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (14 species) not a true protein |
Species Coral (Discosoma sp.) [TaxId:86600] [188539] (17 PDB entries) |
Domain d2vaea_: 2vae A: [168427] automated match to d1g7ka_ complexed with edo |
PDB Entry: 2vae (more details), 1.64 Å
SCOPe Domain Sequences for d2vaea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vaea_ d.22.1.1 (A:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]} vikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfq ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig vnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksiymakkp vqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
Timeline for d2vaea_: