Lineage for d2v9xl_ (2v9x L:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560503Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1560650Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1560651Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1560664Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species)
  7. 1560665Species Escherichia coli [TaxId:562] [117336] (6 PDB entries)
    Uniprot P28248
  8. 1560683Domain d2v9xl_: 2v9x L: [168424]
    automated match to d1xs1a_
    complexed with dut, mg, so4

Details for d2v9xl_

PDB Entry: 2v9x (more details), 2.2 Å

PDB Description: e138d variant of escherichia coli dctp deaminase in complex with dutp
PDB Compounds: (L:) deoxycytidine triphosphate deaminase

SCOPe Domain Sequences for d2v9xl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v9xl_ b.85.4.1 (L:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]}
mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
hvtahridpgwsgcivldfynsgklplalrpgmligalsfeplsgpavrpynrr

SCOPe Domain Coordinates for d2v9xl_:

Click to download the PDB-style file with coordinates for d2v9xl_.
(The format of our PDB-style files is described here.)

Timeline for d2v9xl_: