SCOPe 2.06: Domain d2v9eb_: 2v9e B:

Lineage for d2v9eb_ (2v9e B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
   3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5

4. Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families)

5. Family c.74.1.1: AraD-like aldolase/epimerase [53640] (5 proteins)
   metal (zinc)-ion dependent

6. Protein automated matches [190894] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188311] (7 PDB entries)

8. Domain d2v9eb_: 2v9e B: [168391]
   automated match to d1gt7a_
   complexed with act, zn; mutant

Details for d2v9eb_

PDB Entry: 2v9e, 1.58 Å

PDB Description: l-rhamnulose-1-phosphate aldolase from escherichia coli (mutant e192a-k248w-a273s)

PDB Compounds: (B:) rhamnulose-1-phosphate aldolase

SCOPe Domain Sequences for d2v9eb_:

Sequence; same for both SEQRES and ATOM records:

>d2v9eb_ c.74.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
gilpwmvpgtdaigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
vysmggmwqtisreelialgkrfgvtplasalsl

Timeline for d2v9eb_:

• d2v9eb_ first appeared in SCOPe 2.01
  
• d2v9eb_ appears in SCOPe 2.05
  
• d2v9eb_ appears in SCOPe 2.07
  
• d2v9eb_ appears in the current release, SCOPe 2.08