SCOP 1.73: Domain d1f6fa_: 1f6f A:

Lineage for d1f6fa_ (1f6f A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)

6. Protein Prolactin (placental lactogen) [47278] (2 species)

7. Species Sheep (Ovis aries) [TaxId:9940] [47279] (1 PDB entry)

8. Domain d1f6fa_: 1f6f A: [16839]
   Other proteins in same PDB: d1f6fb1, d1f6fb2, d1f6fc1, d1f6fc2

Details for d1f6fa_

PDB Entry: 1f6f, 2.3 Å

PDB Description: crystal structure of the ternary complex between ovine placental lactogen and the extracellular domain of the rat prolactin receptor

PDB Compounds: (A:) placental lactogen

SCOP Domain Sequences for d1f6fa_:

Sequence, based on SEQRES records:

>d1f6fa_ a.26.1.1 (A:) Prolactin (placental lactogen) {Sheep (Ovis aries) [TaxId: 9940]}
aqhppycrnqpgkcqiplqslfdrattvanynsklagemvnrfdeqygqginseskvinc
htssittpnskaeaintedkilfklvisllhswdeplhhavtelanskgtspalltkaqe
ikekakvlvdgveviqkrihpgeknepypvwseqssltsqdenvrrvafyrlfhclhrds
skiytylrilkcrltsc

Sequence, based on observed residues (ATOM records):

>d1f6fa_ a.26.1.1 (A:) Prolactin (placental lactogen) {Sheep (Ovis aries) [TaxId: 9940]}
aqhppycrnqpgkcqiplqslfdrattvanynsklagemvnrfdeqyvinchtssittpn
skaeaintedkilfklvisllhswdeplhhavtelanpalltkaqeikekakvlvdgvev
iqkrihpgeknepypvwseqssltsqdenvrrvafyrlfhclhrdsskiytylrilkcrl
tsc

Timeline for d1f6fa_:

• d1f6fa_ first appeared (with stable ids) in SCOP 1.55
  
• d1f6fa_ appears in SCOP 1.71
  
• d1f6fa_ appears in SCOP 1.75
  
• d1f6fa_ appears in the current release, SCOPe 2.08