Lineage for d1f6fa_ (1f6f A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767022Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 767023Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 767024Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 767089Protein Prolactin (placental lactogen) [47278] (2 species)
  7. 767093Species Sheep (Ovis aries) [TaxId:9940] [47279] (1 PDB entry)
  8. 767094Domain d1f6fa_: 1f6f A: [16839]
    Other proteins in same PDB: d1f6fb1, d1f6fb2, d1f6fc1, d1f6fc2

Details for d1f6fa_

PDB Entry: 1f6f (more details), 2.3 Å

PDB Description: crystal structure of the ternary complex between ovine placental lactogen and the extracellular domain of the rat prolactin receptor
PDB Compounds: (A:) placental lactogen

SCOP Domain Sequences for d1f6fa_:

Sequence, based on SEQRES records: (download)

>d1f6fa_ a.26.1.1 (A:) Prolactin (placental lactogen) {Sheep (Ovis aries) [TaxId: 9940]}
aqhppycrnqpgkcqiplqslfdrattvanynsklagemvnrfdeqygqginseskvinc
htssittpnskaeaintedkilfklvisllhswdeplhhavtelanskgtspalltkaqe
ikekakvlvdgveviqkrihpgeknepypvwseqssltsqdenvrrvafyrlfhclhrds
skiytylrilkcrltsc

Sequence, based on observed residues (ATOM records): (download)

>d1f6fa_ a.26.1.1 (A:) Prolactin (placental lactogen) {Sheep (Ovis aries) [TaxId: 9940]}
aqhppycrnqpgkcqiplqslfdrattvanynsklagemvnrfdeqyvinchtssittpn
skaeaintedkilfklvisllhswdeplhhavtelanpalltkaqeikekakvlvdgvev
iqkrihpgeknepypvwseqssltsqdenvrrvafyrlfhclhrdsskiytylrilkcrl
tsc

SCOP Domain Coordinates for d1f6fa_:

Click to download the PDB-style file with coordinates for d1f6fa_.
(The format of our PDB-style files is described here.)

Timeline for d1f6fa_: