Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
Protein automated matches [190580] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188312] (2 PDB entries) |
Domain d2v76d_: 2v76 D: [168366] automated match to d1p5ta_ complexed with edo, gol, pge, so4 |
PDB Entry: 2v76 (more details), 1.6 Å
SCOPe Domain Sequences for d2v76d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v76d_ b.55.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sqfwvtvqrteaaercglhgsyvlrveaerltlltvgaqsqilepllswpytllrrygrd kvmfsfeagrrcpsgpgtftfqtaqgndifqavetaihr
Timeline for d2v76d_: