Class b: All beta proteins [48724] (178 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (49 species) not a true protein |
Species Clostridium cellulolyticum [TaxId:1521] [189080] (1 PDB entry) |
Domain d2v4va_: 2v4v A: [168340] automated match to d1gmma_ complexed with na, xyp |
PDB Entry: 2v4v (more details), 1.5 Å
SCOPe Domain Sequences for d2v4va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4va_ b.18.1.0 (A:) automated matches {Clostridium cellulolyticum [TaxId: 1521]} qsaysrieaesysnqsgiqtetcseggedvgfvengdytvynnvdfgdgvggfqarvasa tsggnieirldsstgtligtcpvagtgdwqtytdakctvsgvtgkhdvylvfkgdsgylf nlnwftfse
Timeline for d2v4va_: