Lineage for d2v41h_ (2v41 H:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1601496Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1601835Protein automated matches [190100] (16 species)
    not a true protein
  7. 1601953Species Arenicola marina [TaxId:6344] [188412] (4 PDB entries)
  8. 1601973Domain d2v41h_: 2v41 H: [168331]
    automated match to d1prxb_
    complexed with bez; mutant

Details for d2v41h_

PDB Entry: 2v41 (more details), 2.4 Å

PDB Description: crystal structure of the c45s mutant of the peroxiredoxin 6 of arenicola marina. orthorhombic form
PDB Compounds: (H:) peroxiredoxin 6.

SCOPe Domain Sequences for d2v41h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v41h_ c.47.1.10 (H:) automated matches {Arenicola marina [TaxId: 6344]}
gitlgevfpnfeadstigklkfhdwlgnswgvlfshprdftpvsttelgrviqlegdfkk
rgvklialscdnvadhkewsedvkclsgvkgdmpypiiadetrelavklgmvdpdertst
gmpltcravfiigpdkklklsilypattgrnfseilrvidslqltaqkkvatpadwqpgd
rcmvvpgvsaeeaktlfpnmevkavpsgkgylrytpqpks

SCOPe Domain Coordinates for d2v41h_:

Click to download the PDB-style file with coordinates for d2v41h_.
(The format of our PDB-style files is described here.)

Timeline for d2v41h_: