SCOPe 2.04: Domain d2v1wb_: 2v1w B:

Lineage for d2v1wb_ (2v1w B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (75 PDB entries)

8. Domain d2v1wb_: 2v1w B: [168295]
   automated match to d1rgwa_
   complexed with 1pe, edo, mg

Details for d2v1wb_

PDB Entry: 2v1w, 1.9 Å

PDB Description: crystal structure of human lim protein ril (pdlim4) pdz domain bound to the c-terminal peptide of human alpha-actinin-1

PDB Compounds: (B:) pdz and lim domain protein 4

SCOPe Domain Sequences for d2v1wb_:

Sequence; same for both SEQRES and ATOM records:

>d2v1wb_ b.36.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smphsvtlrgpspwgfrlvggrdfsapltisrvhagskaalaalcpgdliqaingestel
mthleaqnrikgchdhltlsvsrpegesdl

Timeline for d2v1wb_:

• d2v1wb_ first appeared in SCOPe 2.01
  
• d2v1wb_ appears in SCOPe 2.03
  
• d2v1wb_ appears in SCOPe 2.05
  
• d2v1wb_ appears in the current release, SCOPe 2.08, called d2v1wb1