Class a: All alpha proteins [46456] (289 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species) |
Species Dog (Canis familiaris) [TaxId:9615] [47271] (2 PDB entries) |
Domain d1bgeb_: 1bge B: [16824] |
PDB Entry: 1bge (more details), 2.2 Å
SCOPe Domain Sequences for d1bgeb_:
Sequence, based on SEQRES records: (download)
>d1bgeb_ a.26.1.1 (B:) Granulocyte-colony stimulating factor (G-CSF) {Dog (Canis familiaris) [TaxId: 9615]} plpqsfllkcleqmrkvqadgtalqetlcathqlchpeelvllghalgipqpplsscssq alqlmgclrqlhsglflyqgllqalagispelaptldtlqldttdfainiwqqmedlgma pavpptqgtmpaftsafqrraggvlvasnlqsflelayralrhfa
>d1bgeb_ a.26.1.1 (B:) Granulocyte-colony stimulating factor (G-CSF) {Dog (Canis familiaris) [TaxId: 9615]} plpqsfllkcleqmrkvqadgtalqetlcathqlchpeelvllghalgipqpplsscssq alqlmgclrqlhsglflyqgllqalagispelaptldtlqldttdfainiwqqmedlgma patmpaftsafqrraggvlvasnlqsflelayralrhfa
Timeline for d1bgeb_: