Lineage for d1bgeb_ (1bge B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992769Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1992770Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1992771Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 1992778Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)
  7. 1992781Species Dog (Canis familiaris) [TaxId:9615] [47271] (2 PDB entries)
  8. 1992783Domain d1bgeb_: 1bge B: [16824]

Details for d1bgeb_

PDB Entry: 1bge (more details), 2.2 Å

PDB Description: crystal structure of canine and bovine granulocyte-colony stimulating factor (g-csf)
PDB Compounds: (B:) granulocyte colony-stimulating factor

SCOPe Domain Sequences for d1bgeb_:

Sequence, based on SEQRES records: (download)

>d1bgeb_ a.26.1.1 (B:) Granulocyte-colony stimulating factor (G-CSF) {Dog (Canis familiaris) [TaxId: 9615]}
plpqsfllkcleqmrkvqadgtalqetlcathqlchpeelvllghalgipqpplsscssq
alqlmgclrqlhsglflyqgllqalagispelaptldtlqldttdfainiwqqmedlgma
pavpptqgtmpaftsafqrraggvlvasnlqsflelayralrhfa

Sequence, based on observed residues (ATOM records): (download)

>d1bgeb_ a.26.1.1 (B:) Granulocyte-colony stimulating factor (G-CSF) {Dog (Canis familiaris) [TaxId: 9615]}
plpqsfllkcleqmrkvqadgtalqetlcathqlchpeelvllghalgipqpplsscssq
alqlmgclrqlhsglflyqgllqalagispelaptldtlqldttdfainiwqqmedlgma
patmpaftsafqrraggvlvasnlqsflelayralrhfa

SCOPe Domain Coordinates for d1bgeb_:

Click to download the PDB-style file with coordinates for d1bgeb_.
(The format of our PDB-style files is described here.)

Timeline for d1bgeb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bgea_