Lineage for d1pgre_ (1pgr E:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536620Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 536621Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 536622Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 536629Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)
  7. 536636Species Human (Homo sapiens) [TaxId:9606] [47269] (4 PDB entries)
  8. 536644Domain d1pgre_: 1pgr E: [16819]
    Other proteins in same PDB: d1pgrb1, d1pgrb2, d1pgrd1, d1pgrd2, d1pgrf1, d1pgrf2, d1pgrh1, d1pgrh2

Details for d1pgre_

PDB Entry: 1pgr (more details), 3.5 Å

PDB Description: 2:2 complex of g-csf with its receptor

SCOP Domain Sequences for d1pgre_:

Sequence, based on SEQRES records: (download)

>d1pgre_ a.26.1.1 (E:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens)}
gpasslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplss
cpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmee
lgmapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp

Sequence, based on observed residues (ATOM records): (download)

>d1pgre_ a.26.1.1 (E:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens)}
gpasslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplss
cpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmee
lgmaampafasafqrraggvlvashlqsflevsyrvlrhlaqp

SCOP Domain Coordinates for d1pgre_:

Click to download the PDB-style file with coordinates for d1pgre_.
(The format of our PDB-style files is described here.)

Timeline for d1pgre_: