Lineage for d2rl3a_ (2rl3 A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949750Protein Class D beta-lactamase [56622] (4 species)
  7. 1949760Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (27 PDB entries)
  8. 1949785Domain d2rl3a_: 2rl3 A: [168173]
    automated match to d1k4fb_
    complexed with edo, gol, so4; mutant

Details for d2rl3a_

PDB Entry: 2rl3 (more details), 1.9 Å

PDB Description: crystal structure of the oxa-10 w154h mutant at ph 7
PDB Compounds: (A:) Beta-lactamase PSE-2

SCOPe Domain Sequences for d2rl3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rl3a_ e.3.1.1 (A:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
mgsitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigl
etgviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkk
fsygnqnisggidkfhlegqlrisavnqvefleslylnklsaskenqlivkealvteaap
eylvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkim
esegii

SCOPe Domain Coordinates for d2rl3a_:

Click to download the PDB-style file with coordinates for d2rl3a_.
(The format of our PDB-style files is described here.)

Timeline for d2rl3a_: