Lineage for d2rk4a_ (2rk4 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1589127Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1589289Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 1589290Protein DJ-1 [89603] (1 species)
    RNA-binding protein regulatory subunit
  7. 1589291Species Human (Homo sapiens) [TaxId:9606] [89604] (35 PDB entries)
    Uniprot Q99497
  8. 1589296Domain d2rk4a_: 2rk4 A: [168158]
    automated match to d1pdwg_

Details for d2rk4a_

PDB Entry: 2rk4 (more details), 1.15 Å

PDB Description: structure of m26i dj-1
PDB Compounds: (A:) Protein DJ-1

SCOPe Domain Sequences for d2rk4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rk4a_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemetvipvdvirragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

SCOPe Domain Coordinates for d2rk4a_:

Click to download the PDB-style file with coordinates for d2rk4a_.
(The format of our PDB-style files is described here.)

Timeline for d2rk4a_: