Lineage for d2rgib_ (2rgi B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323269Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2323517Protein automated matches [190132] (4 species)
    not a true protein
  7. 2323520Species Human (Homo sapiens) [TaxId:9606] [187203] (41 PDB entries)
  8. 2323551Domain d2rgib_: 2rgi B: [168117]
    automated match to d1m31a_
    complexed with ipa, na

Details for d2rgib_

PDB Entry: 2rgi (more details), 1.6 Å

PDB Description: crystal structure of ca2+-free s100a2 at 1.6 a resolution
PDB Compounds: (B:) Protein S100-A2

SCOPe Domain Sequences for d2rgib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rgib_ a.39.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sssleqalavlvttfhkyssqegdkfklskgemkellhkelpsfvgekvdeeglkklmgs
ldensdqqvdfqeyavflalitvmsndffqgs

SCOPe Domain Coordinates for d2rgib_:

Click to download the PDB-style file with coordinates for d2rgib_.
(The format of our PDB-style files is described here.)

Timeline for d2rgib_: