Class b: All beta proteins [48724] (178 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
Protein automated matches [190873] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries) |
Domain d2re9c_: 2re9 C: [168064] automated match to d1a8ma_ complexed with gol, mg |
PDB Entry: 2re9 (more details), 2.1 Å
SCOPe Domain Sequences for d2re9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2re9c_ b.22.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lradgdkprahltvvrqtptqhfknqfpalhwehelglaftknrmnytnkfllipesgdy fiysqvtfrgmtsecseirqagrpnkpdsitvvitkvtdsypeptqllmgtksvcevgsn wfqpiylgamfslqegdklmvnvsdislvdytkedktffgafll
Timeline for d2re9c_: