Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein delta 9-stearoyl-acyl carrier protein desaturase [47261] (1 species) |
Species Castor bean (Ricinus communis) [TaxId:3988] [47262] (5 PDB entries) |
Domain d1afrb_: 1afr B: [16806] complexed with fe2 |
PDB Entry: 1afr (more details), 2.4 Å
SCOPe Domain Sequences for d1afrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afrb_ a.25.1.2 (B:) delta 9-stearoyl-acyl carrier protein desaturase {Castor bean (Ricinus communis) [TaxId: 3988]} mpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfde qvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtra wtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqera tfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafadm mrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltglsa egqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
Timeline for d1afrb_: