Lineage for d2r96a_ (2r96 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356722Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1357110Family c.23.5.8: WrbA-like [117474] (3 proteins)
  6. 1357119Protein Trp repressor binding protein WrbA [117475] (3 species)
  7. 1357137Species Escherichia coli [TaxId:562] [188617] (3 PDB entries)
  8. 1357142Domain d2r96a_: 2r96 A: [168021]
    automated match to d1zwka1
    complexed with edo, fmn

Details for d2r96a_

PDB Entry: 2r96 (more details), 2.6 Å

PDB Description: crystal structure of e. coli wrba in complex with fmn
PDB Compounds: (A:) Flavoprotein WrbA

SCOPe Domain Sequences for d2r96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r96a_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 562]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng

SCOPe Domain Coordinates for d2r96a_:

Click to download the PDB-style file with coordinates for d2r96a_.
(The format of our PDB-style files is described here.)

Timeline for d2r96a_: