Lineage for d2r96a_ (2r96 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families) 
Family c.23.5.8: WrbA-like [117474] (3 proteins) 
Protein Trp repressor binding protein WrbA [117475] (4 species) 
Species Escherichia coli [TaxId:562] [188617] (3 PDB entries) 
Domain d2r96a_: 2r96 A: [168021]
automated match to d1zwka1
complexed with edo, fmn
Details for d2r96a_
PDB Entry: 2r96 (more details), 2.6 Å
PDB Description: crystal structure of e. coli wrba in complex with fmn
PDB Compounds: (A:) Flavoprotein WrbASCOPe Domain Sequences for d2r96a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r96a_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 562]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng
SCOPe Domain Coordinates for d2r96a_:
Click to download the PDB-style file with coordinates for d2r96a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2r96a_:
- d2r96a_ first appeared in SCOPe 2.01
- d2r96a_ appears in SCOPe 2.07
View in 3D
