SCOPe 2.06: Domain d2r91d_: 2r91 D:

Lineage for d2r91d_ (2r91 D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (75 species)
   not a true protein

7. Species Thermoproteus tenax [TaxId:2271] [188383] (2 PDB entries)

8. Domain d2r91d_: 2r91 D: [168016]
   automated match to d1w37a_
   complexed with so4

Details for d2r91d_

PDB Entry: 2r91, 2 Å

PDB Description: crystal structure of kd(p)ga from t.tenax

PDB Compounds: (D:) 2-Keto-3-deoxy-(6-phospho-)gluconate aldolase

SCOPe Domain Sequences for d2r91d_:

Sequence; same for both SEQRES and ATOM records:

>d2r91d_ c.1.10.0 (D:) automated matches {Thermoproteus tenax [TaxId: 2271]}
meivapvittfrggrldpelfanhvknitskgvdvvfvagttglgpalslqekmeltdaa
tsaarrvivqvaslnadeaialakyaesrgaeavaslppyyfprlserqiakyfrdlcsa
vsipvflynypaavgrdvdaraakelgcirgvkdtneslahtlaykrylpqarvyngsds
lvfasfavrldgvvassanylpellagirdavaagdierarslqflldeivesarhigya
aavyelveifqgyeageprgpvypldpeekawlraavakaksqlrl

Timeline for d2r91d_:

• d2r91d_ first appeared in SCOPe 2.01
  
• d2r91d_ appears in SCOPe 2.05
  
• d2r91d_ appears in SCOPe 2.07
  
• d2r91d_ appears in the current release, SCOPe 2.08