Class a: All alpha proteins [46456] (286 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
Family a.25.2.0: automated matches [191442] (1 protein) not a true family |
Protein automated matches [190652] (6 species) not a true protein |
Species Lactobacillus reuteri [TaxId:1598] [188444] (9 PDB entries) |
Domain d2r6xb_: 2r6x B: [168001] automated match to d1rtyb_ complexed with atp, mg |
PDB Entry: 2r6x (more details), 2.61 Å
SCOPe Domain Sequences for d2r6xb_:
Sequence, based on SEQRES records: (download)
>d2r6xb_ a.25.2.0 (B:) automated matches {Lactobacillus reuteri [TaxId: 1598]} iytkngdkgqtriigkqilykndprvaaygevnelnswvgytkslinshtqvlsneleei qqllfdcghdlatpadderhsfkfkqeqptvwleekidnytqvvpavkkfilpggtqlas alhvartitrraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmlyr
>d2r6xb_ a.25.2.0 (B:) automated matches {Lactobacillus reuteri [TaxId: 1598]} iytkngdkgqtriiqilykndprvaaygevnelnswvgytkslinshtqvlsneleeiqq llfdcghdlatprhsfkfkqeqptvwleekidnytqvvpavkkfilpggtqlasalhvar titrraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmlyr
Timeline for d2r6xb_: