SCOPe 2.07: Domain d2r4wa_: 2r4w A:

Lineage for d2r4wa_ (2r4w A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries)

8. Domain d2r4wa_: 2r4w A: [167977]
   automated match to d1nxfa_
   complexed with cmo, hem

Details for d2r4wa_

PDB Entry: 2r4w, 1.8 Å

PDB Description: ligand migration and binding in the dimeric hemoglobin of scapharca inaequivalvis: m37f with co bound

PDB Compounds: (A:) Globin-1

SCOPe Domain Sequences for d2r4wa_:

Sequence; same for both SEQRES and ATOM records:

>d2r4wa_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalfttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d2r4wa_:

• d2r4wa_ first appeared in SCOPe 2.01
  
• d2r4wa_ appears in SCOPe 2.06
  
• d2r4wa_ appears in the current release, SCOPe 2.08