Lineage for d2r49a_ (2r49 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779081Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2779082Protein Bacillus 1-3,1-4-beta-glucanase [49926] (5 species)
  7. 2779096Species Fibrobacter succinogenes [TaxId:833] [89270] (5 PDB entries)
    a natural circularly permuted protein
  8. 2779100Domain d2r49a_: 2r49 A: [167972]
    automated match to d1mvea_
    complexed with ca, cs; mutant

Details for d2r49a_

PDB Entry: 2r49 (more details), 2.2 Å

PDB Description: mutational and structural studies of e85i reveal the flexible loops of fibrobacter succinogenes 1,3-1,4-beta-d-glucanaseglucanase
PDB Compounds: (A:) Beta-glucanase

SCOPe Domain Sequences for d2r49a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r49a_ b.29.1.2 (A:) Bacillus 1-3,1-4-beta-glucanase {Fibrobacter succinogenes [TaxId: 833]}
sakdfsgaelytleevqygkfearmkmaaasgtvssmflyqngseiadgrpwvevdievl
gknpgsfqsniitgkagaqktsikhhavspaadqafhtyglewtpnyvrwtvdgqevrkt
eggqvsnltgtqglrfnlwssesaawvgqfdesklplfqfinwvkvykytpgqgeggsdf
tldwtdnfdtfdgsrwgkgdwtfdgnrvdltdkniysrdgmlilaltrkgqesfngqvpr
d

SCOPe Domain Coordinates for d2r49a_:

Click to download the PDB-style file with coordinates for d2r49a_.
(The format of our PDB-style files is described here.)

Timeline for d2r49a_: