Lineage for d2r3zb_ (2r3z B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1193305Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1193306Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1193307Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1193566Protein automated matches [190403] (2 species)
    not a true protein
  7. 1193587Species Mouse (Mus musculus) [TaxId:10090] [188560] (1 PDB entry)
  8. 1193589Domain d2r3zb_: 2r3z B: [167967]
    automated match to d1o80a_

Details for d2r3zb_

PDB Entry: 2r3z (more details), 2.5 Å

PDB Description: Crystal structure of mouse IP-10
PDB Compounds: (B:) Small-inducible cytokine B10

SCOPe Domain Sequences for d2r3zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r3zb_ d.9.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iplartvrcncihiddgpvrmraigkleiipaslscprveiiatmkkndeqrclnpeskt
iknlmka

SCOPe Domain Coordinates for d2r3zb_:

Click to download the PDB-style file with coordinates for d2r3zb_.
(The format of our PDB-style files is described here.)

Timeline for d2r3zb_: