Lineage for d2r2na_ (2r2n A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897228Species Human (Homo sapiens) [TaxId:9606] [188446] (28 PDB entries)
  8. 2897240Domain d2r2na_: 2r2n A: [167938]
    automated match to d1x0ma1
    complexed with gol, kyn, pmp

Details for d2r2na_

PDB Entry: 2r2n (more details), 1.95 Å

PDB Description: The crystal structure of human kynurenine aminotransferase II in complex with kynurenine
PDB Compounds: (A:) Kynurenine/alpha-aminoadipate aminotransferase mitochondrial

SCOPe Domain Sequences for d2r2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r2na_ c.67.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mnyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt
iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg
lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp
edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfnk
frvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq
lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv
kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql
ikesl

SCOPe Domain Coordinates for d2r2na_:

Click to download the PDB-style file with coordinates for d2r2na_.
(The format of our PDB-style files is described here.)

Timeline for d2r2na_: