![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188446] (28 PDB entries) |
![]() | Domain d2r2na_: 2r2n A: [167938] automated match to d1x0ma1 complexed with gol, kyn, pmp |
PDB Entry: 2r2n (more details), 1.95 Å
SCOPe Domain Sequences for d2r2na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r2na_ c.67.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mnyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfnk frvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql ikesl
Timeline for d2r2na_: