Lineage for d2qyka_ (2qyk A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1285679Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1285680Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1285765Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1286002Protein automated matches [190370] (1 species)
    not a true protein
  7. 1286003Species Human (Homo sapiens) [TaxId:9606] [187208] (22 PDB entries)
  8. 1286010Domain d2qyka_: 2qyk A: [167884]
    automated match to d1oyna_
    complexed with mg, npv, zn

Details for d2qyka_

PDB Entry: 2qyk (more details), 2.1 Å

PDB Description: Crystal structure of PDE4A10 in complex with inhibitor NPV
PDB Compounds: (A:) Cyclic AMP-specific phosphodiesterase HSPDE4A10

SCOPe Domain Sequences for d2qyka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qyka_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mniprfgvktdqeellaqelenlnkwglnifcvsdyaggrsltcimymifqerdllkkfr
ipvdtmvtymltledhyhadvayhnslhaadvlqsthvllatpaldavftdleilaalfa
aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqedncdifqnlskrq
rqslrkmvidmvlatdmskhmtlladlktmvetkkvtssgvllldnysdriqvlrnmvhc
adlsnptkplelyrqwtdrimaeffqqgdrerergmeispmcdkhtasveksqvgfidyi
vhplwetwadlvhpdaqeildtlednrdwyysai

SCOPe Domain Coordinates for d2qyka_:

Click to download the PDB-style file with coordinates for d2qyka_.
(The format of our PDB-style files is described here.)

Timeline for d2qyka_: