Lineage for d2quxj_ (2qux J:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211268Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1211269Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1211270Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1211409Protein automated matches [190495] (3 species)
    not a true protein
  7. 1211418Species Pseudomonas phage [TaxId:12023] [188304] (2 PDB entries)
  8. 1211427Domain d2quxj_: 2qux J: [167824]
    automated match to d1dwna_
    protein/RNA complex; complexed with gol

Details for d2quxj_

PDB Entry: 2qux (more details), 2.44 Å

PDB Description: pp7 coat protein dimer in complex with rna hairpin
PDB Compounds: (J:) coat protein

SCOPe Domain Sequences for d2quxj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2quxj_ d.85.1.1 (J:) automated matches {Pseudomonas phage [TaxId: 12023]}
smsktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlk
ldqadvvdsglpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvvnlvp
lgr

SCOPe Domain Coordinates for d2quxj_:

Click to download the PDB-style file with coordinates for d2quxj_.
(The format of our PDB-style files is described here.)

Timeline for d2quxj_: