Lineage for d2quxg_ (2qux G:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1033773Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1033774Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1033775Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1033914Protein automated matches [190495] (3 species)
    not a true protein
  7. 1033923Species Pseudomonas phage [TaxId:12023] [188304] (2 PDB entries)
  8. 1033930Domain d2quxg_: 2qux G: [167822]
    automated match to d1dwna_
    protein/RNA complex; complexed with gol

Details for d2quxg_

PDB Entry: 2qux (more details), 2.44 Å

PDB Description: pp7 coat protein dimer in complex with rna hairpin
PDB Compounds: (G:) coat protein

SCOPe Domain Sequences for d2quxg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2quxg_ d.85.1.1 (G:) automated matches {Pseudomonas phage [TaxId: 12023]}
smsktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlk
ldqadvvdsglpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvvnlvp
lgr

SCOPe Domain Coordinates for d2quxg_:

Click to download the PDB-style file with coordinates for d2quxg_.
(The format of our PDB-style files is described here.)

Timeline for d2quxg_: