SCOPe 2.04: Domain d2qqdg_: 2qqd G:

Lineage for d2qqdg_ (2qqd G:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.155: Pyruvoyl-dependent histidine and arginine decarboxylases [56270] (1 superfamily)
   duplication of beta-alpha-beta(2) motif; 4 layers: alpha/beta/beta/alpha; contains "silk" beta-sandwich

4. Superfamily d.155.1: Pyruvoyl-dependent histidine and arginine decarboxylases [56271] (2 families)
   two chains result from self-processing single-chain precursor; form heterohexamer

5. Family d.155.1.2: Arginine decarboxylase [90046] (2 proteins)

6. Protein automated matches [190911] (1 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [188381] (1 PDB entry)

8. Domain d2qqdg_: 2qqd G: [167775]
   automated match to d1n2mc_
   complexed with ag2, mpd, pyr; mutant

Details for d2qqdg_

PDB Entry: 2qqd, 2 Å

PDB Description: n47a mutant of pyruvoyl-dependent arginine decarboxylase from methanococcus jannashii

PDB Compounds: (G:) Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (PvlArgDC)

SCOPe Domain Sequences for d2qqdg_:

Sequence; same for both SEQRES and ATOM records:

>d2qqdg_ d.155.1.2 (G:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
lpntvslvagssegetplnafdgallnagignvalirissimppeaeivplpklpmgalv
ptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaektvremakigfem
rgweldriesiavehtveklgcafaaaalwyk

Timeline for d2qqdg_:

• d2qqdg_ first appeared in SCOPe 2.01
  
• d2qqdg_ appears in SCOPe 2.03
  
• d2qqdg_ appears in SCOPe 2.05
  
• d2qqdg_ appears in the current release, SCOPe 2.08