Lineage for d2qqdg_ (2qqd G:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1224407Fold d.155: Pyruvoyl-dependent histidine and arginine decarboxylases [56270] (1 superfamily)
    duplication of beta-alpha-beta(2) motif; 4 layers: alpha/beta/beta/alpha; contains "silk" beta-sandwich
  4. 1224408Superfamily d.155.1: Pyruvoyl-dependent histidine and arginine decarboxylases [56271] (2 families) (S)
    two chains result from self-processing single-chain precursor; form heterohexamer
  5. 1224429Family d.155.1.2: Arginine decarboxylase [90046] (2 proteins)
  6. 1224450Protein automated matches [190911] (1 species)
    not a true protein
  7. 1224451Species Methanocaldococcus jannaschii [TaxId:2190] [188381] (1 PDB entry)
  8. 1224454Domain d2qqdg_: 2qqd G: [167775]
    automated match to d1n2mc_
    complexed with ag2, mpd, pyr; mutant

Details for d2qqdg_

PDB Entry: 2qqd (more details), 2 Å

PDB Description: n47a mutant of pyruvoyl-dependent arginine decarboxylase from methanococcus jannashii
PDB Compounds: (G:) Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (PvlArgDC)

SCOPe Domain Sequences for d2qqdg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qqdg_ d.155.1.2 (G:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
lpntvslvagssegetplnafdgallnagignvalirissimppeaeivplpklpmgalv
ptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaektvremakigfem
rgweldriesiavehtveklgcafaaaalwyk

SCOPe Domain Coordinates for d2qqdg_:

Click to download the PDB-style file with coordinates for d2qqdg_.
(The format of our PDB-style files is described here.)

Timeline for d2qqdg_: