SCOPe 2.01: Domain d2qlad_: 2qla D:

Lineage for d2qlad_ (2qla D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (2 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)

6. Protein automated matches [190502] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (24 PDB entries)

8. Domain d2qlad_: 2qla D: [167705]
   automated match to d1qq3a_
   complexed with hem, zn

Details for d2qlad_

PDB Entry: 2qla, 2.9 Å

PDB Description: crystal structure of a 16-helix bundle architecture produced by the zinc-mediated self assembly of four cytochrome cb562 molecules

PDB Compounds: (D:) Soluble cytochrome b562

SCOPe Domain Sequences for d2qlad_:

Sequence; same for both SEQRES and ATOM records:

>d2qlad_ a.24.3.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemhd
frhgfdilvgqihdalhlanegkvkeaqaaaeqlkttcnachqkyr

Timeline for d2qlad_:

• d2qlad_ is new in SCOPe 2.01-stable
  
• d2qlad_ appears in SCOPe 2.02
  
• d2qlad_ appears in the current release, SCOPe 2.08