SCOPe 2.05: Domain d2qkqa_: 2qkq A:

Lineage for d2qkqa_ (2qkq A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)

6. Protein automated matches [190030] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187366] (4 PDB entries)

8. Domain d2qkqa_: 2qkq A: [167699]
   automated match to d1b4fb_
   complexed with cl

Details for d2qkqa_

PDB Entry: 2qkq, 2.1 Å

PDB Description: Structure of the SAM Domain of Human Ephrin Type-B Receptor 4

PDB Compounds: (A:) Ephrin type-B receptor 4

SCOPe Domain Sequences for d2qkqa_:

Sequence; same for both SEQRES and ATOM records:

>d2qkqa_ a.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afgsvgewlraikmgryeesfaaagfgsfelvsqisaedllrigvtlaghqkkilasvqh
m

Timeline for d2qkqa_:

• d2qkqa_ first appeared in SCOPe 2.01
  
• d2qkqa_ appears in SCOPe 2.04
  
• d2qkqa_ appears in SCOPe 2.06
  
• d2qkqa_ appears in the current release, SCOPe 2.08