Lineage for d2qjsa_ (2qjs A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231217Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2231218Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 2231341Species Xanthomonas maltophilia [TaxId:40324] [56286] (13 PDB entries)
  8. 2231365Domain d2qjsa_: 2qjs A: [167685]
    automated match to d1smla_
    complexed with zn; mutant

Details for d2qjsa_

PDB Entry: 2qjs (more details), 2.25 Å

PDB Description: stenotrophomonas maltophilia l1 metallo-beta-lactamase asp-120 asn mutant
PDB Compounds: (A:) Metallo-beta-lactamase L1

SCOPe Domain Sequences for d2qjsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qjsa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
pmaplqiadhtwqigtedltallvqtpdgavlldggmpqmashlldnmkargvtprdlrl
illshahanhagpvaelkrrtgakvaanaesavllarggsddlhfgdgityppanadriv
mdgevitvggivftahfmaghtpgstawtwtdtrngkpvriayadslsapgyqlqgnpry
phliedyrrsfatvralpcdvlltphpgasnwdyaagaragakaltckayadaaeqkfdg
qlaketag

SCOPe Domain Coordinates for d2qjsa_:

Click to download the PDB-style file with coordinates for d2qjsa_.
(The format of our PDB-style files is described here.)

Timeline for d2qjsa_: