SCOPe 2.05: Domain d2qima_: 2qim A:

Lineage for d2qima_ (2qim A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)

6. Protein automated matches [190058] (5 species)
   not a true protein

7. Species Yellow lupine (Lupinus luteus) [TaxId:3873] [186854] (2 PDB entries)

8. Domain d2qima_: 2qim A: [167618]
   automated match to d1xdfa1
   complexed with ca, gol, zea

Details for d2qima_

PDB Entry: 2qim, 1.35 Å

PDB Description: Crystal Structure of Pathogenesis-related Protein LlPR-10.2B from yellow lupine in complex with Cytokinin

PDB Compounds: (A:) pr10.2b

SCOPe Domain Sequences for d2qima_:

Sequence; same for both SEQRES and ATOM records:

>d2qima_ d.129.3.1 (A:) automated matches {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gvftfqdeytstiapaklykalvtdadiiipkavetiqsveivegnggpgtikkltfieg
geskyvlhkieaideanlgynysivggvglpdtiekisfetklveganggsigkvtikie
tkgdaqpneeegkaakargdaffkaiesylsahpdyn

Timeline for d2qima_:

• d2qima_ first appeared in SCOPe 2.01
  
• d2qima_ appears in SCOPe 2.04
  
• d2qima_ appears in SCOPe 2.06
  
• d2qima_ appears in the current release, SCOPe 2.08