Lineage for d2qima_ (2qim A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040549Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1040550Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 1040586Protein automated matches [190058] (4 species)
    not a true protein
  7. 1040598Species Yellow lupine (Lupinus luteus) [TaxId:3873] [186854] (2 PDB entries)
  8. 1040599Domain d2qima_: 2qim A: [167618]
    automated match to d1xdfa1
    complexed with ca, gol, zea

Details for d2qima_

PDB Entry: 2qim (more details), 1.35 Å

PDB Description: Crystal Structure of Pathogenesis-related Protein LlPR-10.2B from yellow lupine in complex with Cytokinin
PDB Compounds: (A:) pr10.2b

SCOPe Domain Sequences for d2qima_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qima_ d.129.3.1 (A:) automated matches {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gvftfqdeytstiapaklykalvtdadiiipkavetiqsveivegnggpgtikkltfieg
geskyvlhkieaideanlgynysivggvglpdtiekisfetklveganggsigkvtikie
tkgdaqpneeegkaakargdaffkaiesylsahpdyn

SCOPe Domain Coordinates for d2qima_:

Click to download the PDB-style file with coordinates for d2qima_.
(The format of our PDB-style files is described here.)

Timeline for d2qima_: