Lineage for d2qesa_ (2qes A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1047397Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1047398Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1047399Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1047532Protein automated matches [190420] (8 species)
    not a true protein
  7. 1047576Species Phytolacca dioica [TaxId:29725] [188356] (6 PDB entries)
  8. 1047578Domain d2qesa_: 2qes A: [167565]
    automated match to d1gika_
    complexed with ade

Details for d2qesa_

PDB Entry: 2qes (more details), 1.24 Å

PDB Description: Crystal structure of the ribosome inactivating protein PDL4 from P. dioica leaves in complex with adenine
PDB Compounds: (A:) Ribosome-inactivating protein PD-L4

SCOPe Domain Sequences for d2qesa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qesa_ d.165.1.1 (A:) automated matches {Phytolacca dioica [TaxId: 29725]}
vntitfdvgnatinkyatfmeslrneakdptlkcygipmlpdsnltpkyvlvklqdassk
titlmlrrnnlyvmgysdlyngkcryhifndisstestdventlcpnsnsrekkainyns
qystlqnkagvssrsqvqlgiqilnsdigkisgvstftdkteaefllvaiqmvseaarfk
yienqvktnfnrafnpnpkvlsleenwgkislaihnakngaltsplelknaddtkwivlr
vdeikpdmgllnyvsgtcqtt

SCOPe Domain Coordinates for d2qesa_:

Click to download the PDB-style file with coordinates for d2qesa_.
(The format of our PDB-style files is described here.)

Timeline for d2qesa_: