Lineage for d2qdib_ (2qdi B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2711837Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2711838Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 2711851Protein Odorant binding protein LUSH [101190] (1 species)
  7. 2711852Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries)
  8. 2711867Domain d2qdib_: 2qdi B: [167540]
    automated match to d1ooha_
    complexed with pge; mutant

Details for d2qdib_

PDB Entry: 2qdi (more details), 2 Å

PDB Description: drosophila obp lush d118a mutation
PDB Compounds: (B:) General odorant-binding protein lush

SCOPe Domain Sequences for d2qdib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qdib_ a.39.2.1 (B:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenaagq
fmwp

SCOPe Domain Coordinates for d2qdib_:

Click to download the PDB-style file with coordinates for d2qdib_.
(The format of our PDB-style files is described here.)

Timeline for d2qdib_: