Lineage for d2q7qh_ (2q7q H:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034451Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 3034452Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 3034551Family g.21.1.0: automated matches [191380] (1 protein)
    not a true family
  6. 3034552Protein automated matches [190474] (1 species)
    not a true protein
  7. 3034553Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries)
  8. 3034597Domain d2q7qh_: 2q7q H: [167465]
    automated match to d1mg2b_
    complexed with c2b

Details for d2q7qh_

PDB Entry: 2q7q (more details), 1.6 Å

PDB Description: crystal structure of alcaligenes faecalis aadh in complex with p- chlorobenzylamine.
PDB Compounds: (H:) Aralkylamine dehydrogenase light chain

SCOPe Domain Sequences for d2q7qh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q7qh_ g.21.1.0 (H:) automated matches {Alcaligenes faecalis [TaxId: 511]}
hislnpdlanedevnscdywrhcavdgflcsccggttttcppgstpspiswigtchnphd
gkdylisyhdccgktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvlvg
la

SCOPe Domain Coordinates for d2q7qh_:

Click to download the PDB-style file with coordinates for d2q7qh_.
(The format of our PDB-style files is described here.)

Timeline for d2q7qh_: