SCOPe 2.08: Domain d2q7qh_: 2q7q H:

Lineage for d2q7qh_ (2q7q H:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.0: automated matches [191380] (1 protein)
   not a true family

6. Protein automated matches [190474] (1 species)
   not a true protein

7. Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries)

8. Domain d2q7qh_: 2q7q H: [167465]
   automated match to d1mg2b_
   complexed with c2b

Details for d2q7qh_

PDB Entry: 2q7q, 1.6 Å

PDB Description: crystal structure of alcaligenes faecalis aadh in complex with p- chlorobenzylamine.

PDB Compounds: (H:) Aralkylamine dehydrogenase light chain

SCOPe Domain Sequences for d2q7qh_:

Sequence; same for both SEQRES and ATOM records:

>d2q7qh_ g.21.1.0 (H:) automated matches {Alcaligenes faecalis [TaxId: 511]}
hislnpdlanedevnscdywrhcavdgflcsccggttttcppgstpspiswigtchnphd
gkdylisyhdccgktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvlvg
la

Timeline for d2q7qh_:

• d2q7qh_ first appeared in SCOPe 2.01
  
• d2q7qh_ appears in SCOPe 2.07